General Information

  • ID:  hor003996
  • Uniprot ID:  A0A6I8T824
  • Protein name:  CAPA-Pyrokinin
  • Gene name:  5566490
  • Organism:  Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
  • Family:  Pyrokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Stegomyia (subgenus), Aedes (genus), Aedini (tribe), Culicinae (subfamily), Culicidae (family), Culicoidea (superfamily), Culicomorpha (infraorder), Nematocera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AGNSGANSGMWFGPRL
  • Length:  16
  • Propeptide:  MQQVTQFKTLAYVSLVFVVLSAVKFCRADASDLDSVSEGRHKRGPTVGLFAFPRVGRSDPDLLEWSDAAAVAAALPLELADDYEDYPIREAKRQGLVPFPRVGRSGMNAARFYWPKTMMPQQQKRAGNSGANSGMWFGPRLGKRANAASTEIKGTEVYTPRLGRNSERPQIGESGDLNARSSSRSKLEDFERLFRSSDN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A6I8T824-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003996_AF2.pdbhor003996_ESM.pdb

Physical Information

Mass: 188952 Formula: C70H104N22O21S
Absent amino acids: CDEHIKQTVY Common amino acids: G
pI: 10.55 Basic residues: 1
Polar residues: 8 Hydrophobic residues: 5
Hydrophobicity: -31.88 Boman Index: -1504
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 36.88
Instability Index: -707.5 Extinction Coefficient cystines: 5500
Absorbance 280nm: 366.67

Literature

  • PubMed ID:  20163154
  • Title:  Neuropeptidomics of the Mosquito Aedes Aegypti